DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Ref2

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:233 Identity:81/233 - (34%)
Similarity:117/233 - (50%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDKIEMSLDDIIKSTRSQKKPQAARGGPGGARKTGGQQRFAGGARRGGANAGGSPRKPGSVLKG 65
            |.||::||||||||...::.|...|:           .:|..||:.|...:.||        |:|
  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAK-----------NERVQGGSIRKRNSEGG--------LRG 46

  Fly    66 -PRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELF 129
             .|.....|.::|:||.        :..:...||:        ||.::|.||||||.:.||.|||
  Fly    47 IQRSRNGTGFIRKSKFK--------QETLLKPPKK--------PTLVMVCNLDYGVDDDDIMELF 95

  Fly   130 NDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAVLTRP 194
            |..|.::|..|||||.|.|||||.:.|:.|.:|.:.|:|:|||.||||.:.:.|..:     ||.
  Fly    96 NQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQN-----TRN 155

  Fly   195 VAATDV---KRRVGGTAPTSFKRGGGQAGGTARRGFKR 229
            ...|||   ..|: |:..|.|.:.|.....:.:.||::
  Fly   156 FKRTDVDDLSLRM-GSFKTRFLQNGTFKTRSLQNGFQK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 41/78 (53%)
RRM_THOC4 109..183 CDD:241124 39/73 (53%)
FoP_duplication 214..>265 CDD:290576 3/16 (19%)
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 80/232 (34%)
RRM_SF 75..149 CDD:302621 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I3154
eggNOG 1 0.900 - - E1_KOG0533
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1955
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - P PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.