DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Spx

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:37/86 - (43%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADAL 163
            |.:...:....:..|.||..||.|.:.|||...||:....:..|| :....|...|.|....||.
  Fly     4 GPIAERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDAD 68

  Fly   164 KAIKQYHGVPLDGRPMTIQLA 184
            ..||..:.:.|.|:|:.:..|
  Fly    69 YGIKIMNMIKLYGKPIRVNKA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 24/84 (29%)
RRM_THOC4 109..183 CDD:410081 23/74 (31%)
FoP_duplication 202..>260 CDD:464005
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:409771 23/72 (32%)
RRM2_SF3B4 99..181 CDD:409772
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.