DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Poldip3

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001123978.1 Gene:Poldip3 / 315170 RGDID:1311073 Length:420 Species:Rattus norvegicus


Alignment Length:189 Identity:50/189 - (26%)
Similarity:74/189 - (39%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SPRKPGSVLKGPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYG 119
            :|..|.||.......::...|.|.:.|:            :.|....|......|::.|.||...
  Rat   238 APVLPSSVRTKALTNMSRTLVNKEELPK------------ELPPAEPVLSPLEGTKMTVNNLHPR 290

  Fly   120 VSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQL- 183
            |:..||.|||...|.:|:|.:.:.      |.|:|:|.::.||:.|.|:|:...|||:||...| 
  Rat   291 VTEEDIVELFCVCGALKRARLVHP------GVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLH 349

  Fly   184 -----AVSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTARRGFKRPVGGKPAA 237
                 ..||..:|.|...:..||:.                ....|||  .||...|.|
  Rat   350 MNGNVITSDQPILLRLSDSPSVKKE----------------SELPRRG--NPVSSNPPA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 28/84 (33%)
RRM_THOC4 109..183 CDD:241124 27/73 (37%)
FoP_duplication 214..>265 CDD:290576 7/24 (29%)
Poldip3NP_001123978.1 RRM 216..406 CDD:223796 50/189 (26%)
RRM_SKAR 280..348 CDD:241125 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.