DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and RBMX

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:215 Identity:51/215 - (23%)
Similarity:78/215 - (36%) Gaps:73/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALKAIKQYHG 171
            |.:|.:|.|:...:...::.:|..:|.|.:..:..|| :.:|.|.|.|.||..|||..|.:..:|
Human     7 PGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNG 71

  Fly   172 VPLDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSFKRG------GGQAGGTARRG---- 226
            ..|||:.:.::.|       |:|  :.:..||  |..|....||      ||:.|....||    
Human    72 KSLDGKAIKVEQA-------TKP--SFESGRR--GPPPPPRSRGPPRGLRGGRGGSGGTRGPPSR 125

  Fly   227 -----------------------FKRPVGGKPAAGGQRRERKA---------------------- 246
                                   .||  |..|.:||...:|.|                      
Human   126 GGHMDDGGYSMNFNMSSSRGPLPVKR--GPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRD 188

  Fly   247 ----PPTAEELDAELDSYIN 262
                ||..|.|.:..|.|::
Human   189 SYGGPPRREPLPSRRDVYLS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 23/76 (30%)
RRM_THOC4 109..183 CDD:410081 22/74 (30%)
FoP_duplication 202..>260 CDD:464005 24/116 (21%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 24/85 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 35/161 (22%)
dnaA 165..>306 CDD:455861 7/44 (16%)
RBM1CTR 173..217 CDD:400429 6/36 (17%)
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236 6/23 (26%)
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.