DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and mlo3

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_595715.1 Gene:mlo3 / 2540565 PomBaseID:SPBC1D7.04 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:77/267 - (28%)
Similarity:109/267 - (40%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIEMSLDDIIKSTRSQKKPQAARGGPGGARKTGGQQRFAGGARRGGANAGGSPRKPGSVLKGPRG 68
            :::.|||.||.|     ||:      ||.||           ||..:|   .| ||         
pombe     4 ELDQSLDAIIAS-----KPK------GGIRK-----------RRARSN---KP-KP--------- 33

  Fly    69 GVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELF-NDF 132
                  .:.|| |..:..||.|..:            |..:::||.||...|:...:|||| ...
pombe    34 ------TKNAK-PAVNTASALKSVI------------SEESKIIVSNLPTDVTEAQVKELFVKSI 79

  Fly   133 GPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDG-RPMTIQLAVSDVAVLTRPVA 196
            ||.|:.::.|..:|||.|.|.:||.|..||.:|.:||.|..:|| |.|.:::.:           
pombe    80 GPCKRVSLAYGPNGRSKGIATIIFSRPGDATRAYEQYEGRLVDGTRKMKVEIIL----------- 133

  Fly   197 ATDVKRRVGGTA----PTSFKRGGGQAGGTARRGFKRPVGGKPAAGGQRRERKAP----PTAEEL 253
              |..|::...|    |.|      .|..||.:.     |.|.:.....|.|:.|    .:||||
pombe   134 --DPSRQLNSLAARVSPAS------NASATASKN-----GAKSSKRKTTRRRRTPNRPKKSAEEL 185

  Fly   254 DAELDSY 260
            |.|:|.|
pombe   186 DKEMDDY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 31/80 (39%)
RRM_THOC4 109..183 CDD:241124 31/75 (41%)
FoP_duplication 214..>265 CDD:290576 16/51 (31%)
mlo3NP_595715.1 RRM <2..196 CDD:223796 77/267 (29%)
RRM_YRA1_MLO3 56..132 CDD:240713 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3154
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1955
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 1 1.000 - - oto100754
orthoMCL 1 0.900 - - OOG6_101458
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5291
SonicParanoid 1 1.000 - - X843
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.