DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Rbm4

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_033058.2 Gene:Rbm4 / 19653 MGIID:1100865 Length:361 Species:Mus musculus


Alignment Length:118 Identity:31/118 - (26%)
Similarity:49/118 - (41%) Gaps:29/118 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVP 173
            |:|.|||:....:|.:::..|.::||:.:..:..|       .|.|..||..||::||:......
Mouse    78 TKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKD-------YAFVHMERAEDAVEAIRGLDNTE 135

  Fly   174 LDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTARRG 226
            ..|:.|.:||:.|.:.                 |||     |.|...|..|.|
Mouse   136 FQGKRMHVQLSTSRLR-----------------TAP-----GMGDQSGCYRCG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 21/74 (28%)
RRM_THOC4 109..183 CDD:410081 20/73 (27%)
FoP_duplication 202..>260 CDD:464005 8/25 (32%)
Rbm4NP_033058.2 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 20/72 (28%)
PTZ00368 <145..>181 CDD:173561 10/44 (23%)
ZnF_C2HC 161..176 CDD:197667 3/6 (50%)
Interaction with TNPO3. /evidence=ECO:0000250 196..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.