DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and aly-3

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001076697.1 Gene:aly-3 / 178157 WormBaseID:WBGene00000122 Length:240 Species:Caenorhabditis elegans


Alignment Length:279 Identity:82/279 - (29%)
Similarity:122/279 - (43%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEMSLDDIIKSTRSQKKPQAARGGPGGARKTGG--QQRFAGGARRGGANAGGSPRKPGSVLKGPR 67
            :::||:|||..|                |||.|  |::..||||||.....|.||:.|.     .
 Worm     7 VDLSLEDIISKT----------------RKTTGSIQKKSFGGARRGNTRPTGLPRRSGG-----S 50

  Fly    68 GGVAAGAVQKAKFPRGDVNSAWKH-DMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFND 131
            ||                   ||. |........:.|..|...|:.:.||...|.::|::|||.|
 Worm    51 GG-------------------WKDLDAVQNHGISSRGNDSKVIRVNISNLAPTVISSDLEELFGD 96

  Fly   132 FGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAVLTRPVA 196
            : .:...:|:::..|.||||.|:...:| ||.:.::::.||.|||:.|  :.||.|.:.:...|.
 Worm    97 Y-RLSSVSVNFNEHGDSLGTGDISLTKR-DAERLVQKFSGVALDGKIM--KFAVIDSSNMAGRVD 157

  Fly   197 ATDVKRRVGGTA--------------PTSFKRGGGQA-----GGTARRGFKRPVGGKPAAGGQRR 242
            ..:..|...|.:              |..|.|.|..|     ||..|.||::  ||:    |..|
 Worm   158 FGNRSRSSPGRSSRGFQSGPRRNNGKPEDFLRDGVHAGDIKRGGAGRGGFRK--GGR----GGAR 216

  Fly   243 ERKAPPTAEELDAELDSYI 261
            :.|...|..||||||::|:
 Worm   217 DAKPKKTEAELDAELEAYM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 27/78 (35%)
RRM_THOC4 109..183 CDD:241124 25/73 (34%)
FoP_duplication 214..>265 CDD:290576 21/53 (40%)
aly-3NP_001076697.1 RRM_Aly_REF_like 74..146 CDD:240864 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3780
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58344
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14420
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - LDO PTHR19965
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.