DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and C02B10.4

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_500722.1 Gene:C02B10.4 / 177283 WormBaseID:WBGene00015329 Length:211 Species:Caenorhabditis elegans


Alignment Length:205 Identity:55/205 - (26%)
Similarity:79/205 - (38%) Gaps:73/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RGD-VNSAWKHDMYD----GPKR----------------GAVGGG-------------------- 105
            ||. ::..||.||:.    .||:                ||...|                    
 Worm    21 RGSGIDGKWKRDMFQTANRSPKQNFTTKRRAQTNFVTKAGAAAAGLATRNISTASIRGRTAPAVV 85

  Fly   106 ----SGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADAL--K 164
                :||:.||:.||...|:..|::|||..:.| :...:||..:|.|.|.||:|......|:  |
 Worm    86 REIHTGPSTLIIKNLATTVTQEDLEELFEQYEP-ELVQLHYGPTGESNGCADLIVPHAQVAIIQK 149

  Fly   165 AIKQYHGVPLDGRPMTIQLA--VSDVAVLTRPVAATDVKRRVGGTAPTSFK----------RGGG 217
            |::   ||.|||.|:.:..|  ...|:|..|      :|:...|   ..||          :||.
 Worm   150 ALE---GVLLDGEPIEVLEANPPKQVSVFDR------IKKVSRG---NDFKAKNMRVVVKSKGGF 202

  Fly   218 QAGGTARRGF 227
            |..| ||..|
 Worm   203 QKRG-ARGDF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 29/82 (35%)
RRM_THOC4 109..183 CDD:241124 27/75 (36%)
FoP_duplication 214..>265 CDD:290576 7/14 (50%)
C02B10.4NP_500722.1 RRM_Aly_REF_like 93..163 CDD:240864 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.