DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and daz-1

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_495036.3 Gene:daz-1 / 173931 WormBaseID:WBGene00000935 Length:498 Species:Caenorhabditis elegans


Alignment Length:76 Identity:19/76 - (25%)
Similarity:33/76 - (43%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGV 172
            |.|:.||......:.|:::|.|..|..:|...:.....|:|.|...:.||.. |..:.|::....
 Worm    65 PNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKGYGFITFETE-DQAEEIRKLTPK 128

  Fly   173 PLDGRPMTIQL 183
            .|:.|...:.|
 Worm   129 QLEFRSRKLNL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 19/76 (25%)
RRM_THOC4 109..183 CDD:410081 17/73 (23%)
FoP_duplication 202..>260 CDD:464005
daz-1NP_495036.3 RRM_DAZL_BOULE 64..145 CDD:409846 19/76 (25%)
PABP-1234 <66..265 CDD:130689 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.