powered by:
Protein Alignment Ref1 and R06C1.4
DIOPT Version :9
Sequence 1: | NP_651968.1 |
Gene: | Ref1 / 44029 |
FlyBaseID: | FBgn0010774 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493029.1 |
Gene: | R06C1.4 / 173076 |
WormBaseID: | WBGene00011059 |
Length: | 84 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 38/73 - (52%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 VGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALKAIKQYHGVPLDG 176
|||:.|..:..:|...|...|.:....:.||| :||..|.|.|.|...|.|.:|::|.:||..:|
Worm 10 VGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVAFNG 74
Fly 177 RPMTIQLA 184
|.:.:..|
Worm 75 RNLRVNYA 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2025 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.