DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Rbm39

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573505.2 Gene:Rbm39 / 170791 MGIID:2157953 Length:530 Species:Mus musculus


Alignment Length:128 Identity:37/128 - (28%)
Similarity:57/128 - (44%) Gaps:23/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIK 167
            |.:||.||.||:|.:.::...::.:|..||.|:...:..| .:|||.|...:.|.....|.||::
Mouse   245 GSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALE 309

  Fly   168 QYHGVPLDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSF------KRGGGQAGGTAR 224
            |.:|..|.||||.:                ..|..|...::.:||      :|.|...|.|.|
Mouse   310 QLNGFELAGRPMKV----------------GHVTERTDASSASSFLDSDELERTGIDLGTTGR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 28/80 (35%)
RRM_THOC4 109..183 CDD:410081 25/74 (34%)
FoP_duplication 202..>260 CDD:464005 8/29 (28%)
Rbm39NP_573505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 37/128 (29%)
Interaction with JUN. /evidence=ECO:0000269|PubMed:11704680 291..406 21/82 (26%)
Activating domain 291..355 19/79 (24%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000269|PubMed:11704680 355..406 1/2 (50%)
Interaction with NCOA6. /evidence=ECO:0000269|PubMed:11704680 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.