DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and HNRNPA1L2

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001011724.1 Gene:HNRNPA1L2 / 144983 HGNCID:27067 Length:320 Species:Homo sapiens


Alignment Length:142 Identity:35/142 - (24%)
Similarity:58/142 - (40%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALK-AIKQYHGV 172
            ::.||.:........:::.|..:|.|:...:..|| ||:..|.|.|.|:......| .|::||.|
Human   106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTV 170

  Fly   173 PLDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGT----------APTSFKRGGGQAGGTARRGF 227
              .|....::.|:....:.:  .:::...||..|.          ...:|.|||..:|   |.||
Human   171 --KGHNCEVRKALPKQEMAS--ASSSQRGRRGSGNFGGGRGDGFGGNDNF
GRGGNFSG---RGGF 228

  Fly   228 KRPVGGKPAAGG 239
                ||....||
Human   229 ----GGSCGGGG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 19/75 (25%)
RRM_THOC4 109..183 CDD:410081 19/74 (26%)
FoP_duplication 202..>260 CDD:464005 15/48 (31%)
HNRNPA1L2NP_001011724.1 Globular A domain 4..94
RRM1_hnRNPA1 12..92 CDD:410154
Globular B domain 95..185 20/80 (25%)
RRM_SF 105..184 CDD:473069 20/79 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..216 3/36 (8%)
RNA-binding RGG-box 218..240 11/26 (42%)
HnRNPA1 255..292 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 268..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..320
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.