DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and RBM7

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens


Alignment Length:118 Identity:38/118 - (32%)
Similarity:57/118 - (48%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALK 164
            ||....:..| |.||||:..|:...:.|||:..||:.|..:..|:.|:....|.|.|:.......
Human     2 GAAAAEADRT-LFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPY 65

  Fly   165 AIKQYHGVPLDGRPMTIQL------AVSDVAVLTRPVAATDVKRRVGGTAPTS 211
            |:...:|:.|.|||:.||.      |..||: |:.|      :..||.::|||
Human    66 AMNLLNGIKLYGRPIKIQFRSGSSHAPQDVS-LSYP------QHHVGNSSPTS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 28/89 (31%)
RRM_THOC4 109..183 CDD:410081 25/73 (34%)
FoP_duplication 202..>260 CDD:464005 5/10 (50%)
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 24/74 (32%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.