DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Gm21312

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001257571.1 Gene:Gm21312 / 100861901 MGIID:5434667 Length:264 Species:Mus musculus


Alignment Length:296 Identity:106/296 - (35%)
Similarity:141/296 - (47%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDKIEMSLDDIIKSTRSQKKPQAARGGPGGARKTG-GQQRFAGGARRGGANAGGSPRKPGSVLK 64
            |.||::|||:||||.|:.|   |.....|......| |.:|:......||.|.            
Mouse     4 MADKMDMSLEDIIKLTKIQ---QRRHDRPDSRVNRGTGSKRYRPAFTHGGRNR------------ 53

  Fly    65 GPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGA----VGGGSGPTRLIVGNLDYGVSNTDI 125
                  .|...:..:.|     ..|:||::.|..||.    .||     :|.:.||.:|||:.||
Mouse    54 ------LAPYCRPKQLP-----DKWQHDLFIGGFRGQNHVDTGG-----KLFLSNLHFGVSDADI 102

  Fly   126 KELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAV 190
            :.||.:||.:||:||||||.|||||||.|.|||:||||||:::|:|.|||||||.||||.|.:..
Mouse   103 QLLFAEFGTLKKSAVHYDRCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDR 167

  Fly   191 LTRPVAATDVKRRVGGTAPTSFKRGGG--QAGGTARRGFKRPVGGKPAAG--------------- 238
            ..||..:   |.|.|.|.    ..|.|  ..|||.    |..:||....|               
Mouse   168 QGRPAQS---KNRGGMTR----NPGSGVLSGGGTK----KWTLGGSQGRGRGTIRNSKLQQQQQQ 221

  Fly   239 --------------GQRRERKAPPTAEELDAELDSY 260
                          .|:::::...:||||||:||:|
Mouse   222 QKQKQQQQQQKQQQKQQQKQQQQLSAEELDAQLDAY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 50/78 (64%)
RRM_THOC4 109..183 CDD:241124 47/73 (64%)
FoP_duplication 214..>265 CDD:290576 19/78 (24%)
Gm21312NP_001257571.1 FYTT 6..>59 CDD:284488 20/73 (27%)
RRM <79..>186 CDD:223796 59/118 (50%)
RRM_THOC4 86..160 CDD:241124 48/78 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.