DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Gm21293

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001257827.1 Gene:Gm21293 / 100861880 MGIID:5434648 Length:264 Species:Mus musculus


Alignment Length:296 Identity:106/296 - (35%)
Similarity:141/296 - (47%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDKIEMSLDDIIKSTRSQKKPQAARGGPGGARKTG-GQQRFAGGARRGGANAGGSPRKPGSVLK 64
            |.||::|||:||||.|:.|   |.....|......| |.:|:......||.|.            
Mouse     4 MADKMDMSLEDIIKLTKIQ---QRRHDRPDSRVNRGTGSKRYRPAFTHGGRNR------------ 53

  Fly    65 GPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGA----VGGGSGPTRLIVGNLDYGVSNTDI 125
                  .|...:..:.|     ..|:||::.|..||.    .||     :|.:.||.:|||:.||
Mouse    54 ------LAPYCRPKQLP-----DKWQHDLFIGGFRGQNHVDTGG-----KLFLSNLHFGVSDADI 102

  Fly   126 KELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAV 190
            :.||.:||.:||:||||||.|||||||.|.|||:||||||:::|:|.|||||||.||||.|.:..
Mouse   103 QLLFAEFGTLKKSAVHYDRCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDR 167

  Fly   191 LTRPVAATDVKRRVGGTAPTSFKRGGG--QAGGTARRGFKRPVGGKPAAG--------------- 238
            ..||..:   |.|.|.|.    ..|.|  ..|||.    |..:||....|               
Mouse   168 QGRPAQS---KNRGGMTR----NPGSGVLSGGGTK----KWTLGGSQGRGRGTIRNSKLQQQQQQ 221

  Fly   239 --------------GQRRERKAPPTAEELDAELDSY 260
                          .|:::::...:||||||:||:|
Mouse   222 QKQKQQQQQQKQQQKQQQKQQQQLSAEELDAQLDAY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 50/78 (64%)
RRM_THOC4 109..183 CDD:241124 47/73 (64%)
FoP_duplication 214..>265 CDD:290576 19/78 (24%)
Gm21293NP_001257827.1 FYTT 6..>59 CDD:284488 20/73 (27%)
RRM <79..>186 CDD:223796 59/118 (50%)
RRM_THOC4 86..160 CDD:241124 48/78 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5923
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3746
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58344
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 1 1.000 - - otm42753
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X843
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.