DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and poldip3

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_009297280.3 Gene:poldip3 / 100536140 ZFINID:ZDB-GENE-120201-2 Length:520 Species:Danio rerio


Alignment Length:119 Identity:39/119 - (32%)
Similarity:56/119 - (47%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRS 145
            |.|...||..|.    |.:.......| |::.|.||...|:..||.|||...|.:|:|.:     
Zfish   340 PAGRDTSAQTHT----PTQPVFSPLEG-TKITVTNLHPRVTEEDIVELFCVCGALKRARL----- 394

  Fly   146 GRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQL------AVSDVAVLTR 193
             ..:|.|:|:|.|:.||:.|.::|:...|||:||...|      ..||..:|.|
Zfish   395 -AKVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKCNLHMQGSVITSDQPILLR 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 28/84 (33%)
RRM_THOC4 109..183 CDD:241124 27/73 (37%)
FoP_duplication 214..>265 CDD:290576
poldip3XP_009297280.3 RRM_SKAR 363..431 CDD:241125 27/73 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.