DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Gm4305

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001160111.1 Gene:Gm4305 / 100043235 MGIID:3782485 Length:289 Species:Mus musculus


Alignment Length:317 Identity:106/317 - (33%)
Similarity:140/317 - (44%) Gaps:88/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDKIEMSLDDIIKSTRSQKKPQAARGGPGGARKTG-GQQRFAGGARRGGANAGGSPRKPGSVLK 64
            |.||::|||:||||..:.|   |..|..|....|.| |.:|:......||.|.            
Mouse     4 MADKMDMSLEDIIKLNKMQ---QGRRDRPDSRVKRGTGPKRYRPAFTHGGRNR------------ 53

  Fly    65 GPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGA----VGGGSGPTRLIVGNLDYGVSNTDI 125
                  .|...:..:.|     ..|:||::.|..||.    .||     :|.:.||.:|||:.||
Mouse    54 ------LAPYCRPKQLP-----DKWQHDLFIGGFRGQNHVDTGG-----KLFLSNLHFGVSDADI 102

  Fly   126 KELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAV 190
            :.||.:||.:||:||||||.|||||||.|.|||:||||||:::|:|.|||||||.|.|..|.:..
Mouse   103 QLLFAEFGTLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDR 167

  Fly   191 LTRPVAATD---VKRRVG-----GTAPTSFKRGGGQAGGTARRGFKR------------------ 229
            ..||...:|   :.|..|     |.....:..||.|..|   ||..|                  
Mouse   168 QGRPALNSDKGGMTRNPGSGVLSGGGTKRWTLGGSQGSG---RGTSRNSKLQQQQQQQQQQEEQK 229

  Fly   230 --------------PVGGKPAAGGQRRERKAPP--------TAEELDAELDSYINDM 264
                          ..|.......|::|::...        :.|||||:|| |..||
Mouse   230 HQKQQQQKQQQQQQKQGQNHQHQQQQKEQQQQQQQKELQQLSVEELDAQLD-YYQDM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 48/78 (62%)
RRM_THOC4 109..183 CDD:241124 47/73 (64%)
FoP_duplication 214..>265 CDD:290576 20/91 (22%)
Gm4305NP_001160111.1 FYTT 6..>59 CDD:284488 21/73 (29%)
RRM <79..>163 CDD:223796 50/88 (57%)
RRM_THOC4 86..160 CDD:241124 48/78 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5923
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3746
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 1 1.000 - - otm42753
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X843
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.