DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GOLGA6L22 and cank-26

DIOPT Version :9

Sequence 1:NP_001382774.1 Gene:GOLGA6L22 / 440243 HGNCID:50289 Length:810 Species:Homo sapiens
Sequence 2:NP_494702.2 Gene:cank-26 / 173739 WormBaseID:WBGene00019641 Length:459 Species:Caenorhabditis elegans


Alignment Length:514 Identity:113/514 - (21%)
Similarity:244/514 - (47%) Gaps:107/514 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   288 RRQEEMMWEKEEKMRR----QEEMMWEKEEKIRELEEKM----HEQEKIREQEEK----RQEEEK 340
            |||.   :.:.:::.|    :.|::.:.:|..|.|:||.    .|.|.:|:::||    .:..||
 Worm     4 RRQN---YSEVDELNRILMVERELVLKTQENYRILKEKFLSLSKEHEHLRKEQEKWAEGAESREK 65

Human   341 IREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEE 405
            ::|.|.|.::..|:.||    ..||.::|.::.|:    :.|.|.:.:    .|:|.::...|.:
 Worm    66 LQELEGRSDELIKIMRQ----ANQEREVRYEKFKV----DTIEELQNV----YRKELQDQNNQID 118

Human   406 KIR-EQEEIWRQKEKMHEQEEKIRKQEEKVWRQEEKMHDQEEKIREQEEKVWRQEEKIREQEKKR 469
            |:| :::|:.::.:::.|:          :.....||.|            ::::||.:|.|.:.
 Worm   119 KLRIDRQELVKENDQLLEE----------IAEMSTKMDD------------YKRKEKAKEVEMRM 161

Human   470 EQEEKMWRQEEKIREQEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQ----EDKMWRQEEKIRE 530
            :.::|:   ::.:..:|:::..     |.|...|:.|.:..|.:::|:    :.:.:..|..::.
 Worm   162 KYDQKL---KDIVMNKEKRVSP-----RFEHLEHKIEDLHAEIQKKEELILLKSRQFASEISLKN 218

Human   531 QE-EKVWRQEEKIREQEEKRQEQEEKMWKQEEKIREQEEKIREQEEKIREQEEKIRE--QEEMMQ 592
            .| |.:.|.|...:.|..:.::..:.:....|||..:.::....|....:.||.::|  ..||.|
 Worm   219 GEIEDLKRSEAYAKSQISQLEDTVKSLKLHIEKIASENDQTVVVETLRLKNEELLKENLNLEMKQ 283

Human   593 EQEE-----KMGEQEE----KMQEQEKMRRQEE-KIREQEEKIREQKEKIREQEEKIWEQEEKIR 647
            .||:     ::.:.||    ::.|.||:..|:: ||    |.:..|.||....:|.: |:.::.|
 Worm   284 RQEQLDFARQLADSEETFSVRISEFEKLCEQKDLKI----EDLHSQLEKCDRLQESL-EKADRSR 343

Human   648 EQEEMMQEQEEKMGEQEEKIWEQEEKMQEQEEKMR--------RQEEKIREQEKKIR------EQ 698
            :.||   |..|::..:.:.::|:.:|..|..:|:.        |.|..:...:||:.      |.
 Worm   344 QIEE---EHRERLELEVKSLYEKLQKSAEDRQKVETTLKLDRDRLEVSLVTMKKKLESTPEAPEN 405

Human   699 EEKIREQEEMMQEQEEKMGEQEEKMQ----EQEEKMRRQEEKIREQEKKIREQEEKIRE 753
            .||:|::   :::.|::...::||.|    |.:..::|.|...|:...|:   :|||.|
 Worm   406 VEKLRKE---LRDSEKRRLSEKEKHQAITSELKSALKRLERSYRDAVIKL---QEKIPE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GOLGA6L22NP_001382774.1 None
cank-26NP_494702.2 RNase_Y 36..>164 CDD:188306 35/161 (22%)
SMC_prok_A <106..443 CDD:274009 77/377 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.