DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and SAP1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_010966.1 Gene:SAP1 / 856771 SGDID:S000000849 Length:897 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:113/333 - (33%)
Similarity:183/333 - (54%) Gaps:31/333 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSKNKKKAK-VLAEEQLKRLAEQEGF-KLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVI 106
            ||.|:::.: .:.::.|:.:.|.|.. .|:|.: ......|.:.:||..| .|.|.|||||:|..
Yeast   552 TSLNEQREEPEIDKKVLREILEDEIIDSLQGVD-RQAAKQIFAEIVVHGD-EVHWDDIAGLESAK 614

  Fly   107 QELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDK 171
            ..|:|:||.|....|||:  .|.:..:|:||.||||.|||::|:|.|.|:...|.::..:.||.|
Yeast   615 YSLKEAVVYPFLRPDLFR--GLREPVRGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSK 677

  Fly   172 WYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSR-NMNDHEATAMMKTQFMMLWDGLS----- 230
            :.|||:||..|:|::|.::.|.|||:|||||.:.|| |.|::|::..:|.:|::.|..||     
Yeast   678 YLGESEKLVRALFAIAKKLSPSIIFVDEIDSIMGSRNNENENESSRRIKNEFLVQWSSLSSAAAG 742

  Fly   231 -----TNANST--------VIVMGATNRPQDLDKAIVRRMPAQFHIGLP-SETQRKDILKLILQS 281
                 ||.:.|        |:|:.|||.|..:|:|..||...:.:|.|| .:|:.....||:...
Yeast   743 SNKSNTNNSDTNGDEDDTRVLVLAATNLPWSIDEAARRRFVRRQYIPLPEDQTRHVQFKKLLSHQ 807

  Fly   282 EEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVR-ITMDDLLG 345
            :....:.|.:.|.|:|.|:||||:..:.::|::..:|.|    .......:|..:| |.:.|...
Yeast   808 KHTLTESDFDELVKITEGYSGSDITSLAKDAAMGPLRDL----GDKLLETEREMIRPIGLVDFKN 868

  Fly   346 SHLKIKES 353
            |.:.||.|
Yeast   869 SLVYIKPS 876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 59/152 (39%)
AAA 135..265 CDD:278434 58/148 (39%)
SAP1NP_010966.1 Herpes_BLLF1 <353..543 CDD:282904
SpoVK <557..890 CDD:223540 110/328 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.