DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and CDC48

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_010157.1 Gene:CDC48 / 851431 SGDID:S000002284 Length:835 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:98/314 - (31%)
Similarity:163/314 - (51%) Gaps:31/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQLKRLAEQEGFKLRG----QEFSDYELMIASHLVVPADITVSWA-------------------D 98
            |..:.:.:.:.|.:||    .||...::....:.||..|..:.|.                   |
Yeast   151 EAYRPVRKGDHFVVRGGMRQVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDD 215

  Fly    99 IAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINL 163
            |.|....:.::||.|.||::|..|||...: :.|:|||::||||.||||:|:|.|.|.|..|..:
Yeast   216 IGGCRKQMAQIREMVELPLRHPQLFKAIGI-KPPRGVLMYGPPGTGKTLMARAVANETGAFFFLI 279

  Fly   164 DVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDG 228
            :...:..|..|||:......|..|.:..|.|||||||||....|:..:.|....:.:|.:.|.||
Yeast   280 NGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDG 344

  Fly   229 LSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLN 291
            :  .|.|.|:|:.|||||..:|.|:.|  |...:..||:|..|.|.::|::..::.:::.||||.
Yeast   345 M--KARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLE 407

  Fly   292 RLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDR---NNVRITMDD 342
            .|:..|:|:.|:|:..:|..|::.::|:.:...|.....:|.   :::.:|||:
Yeast   408 ALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 55/135 (41%)
AAA 135..265 CDD:278434 52/131 (40%)
CDC48NP_010157.1 CDC48 48..785 CDD:273521 98/314 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.