DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and AFG2

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_013501.1 Gene:AFG2 / 851113 SGDID:S000004389 Length:780 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:87/285 - (30%)
Similarity:149/285 - (52%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGM 158
            :|:|.:.|||..|:.|:.::.:|:....||....: ..|:|:|||||||.|||::.:..|..:..
Yeast   242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGV-SPPRGILLHGPPGTGKTMLLRVVANTSNA 305

  Fly   159 RFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSR-NMNDHEATAMMKTQF 222
            ..:.::...:..|:.||::.....:|:.|.:.:|.|||||||||...:| |.:..|..:.:....
Yeast   306 HVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEIDSIAPNRANDDSGEVESRVVATL 370

  Fly   223 MMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQF----HIGLPSETQRKDIL-------- 275
            :.|.||:  .|...|:|:.|||||..:|.|:  |.|.:|    .||:|....|.|||        
Yeast   371 LTLMDGM--GAAGKVVVIAATNRPNSVDPAL--RRPGRFDQEVEIGIPDVDARFDILTKQFSRMS 431

  Fly   276 --KLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRI 338
              :.:|.||.:..      ::..|:|:.|:||..:||. ||.:..|.....|.:   :|:.::::
Yeast   432 SDRHVLDSEAIKY------IASKTHGYVGADLTALCRE-SVMKTIQRGLGTDAN---IDKFSLKV 486

  Fly   339 TMDDLLGSHLKIKESKMHTSSLFLE 363
            |:.|:..:.:.|:.|.|.  .:|||
Yeast   487 TLKDVESAMVDIRPSAMR--EIFLE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 49/138 (36%)
AAA 135..265 CDD:278434 46/134 (34%)
AFG2NP_013501.1 CDC48 51..773 CDD:273521 87/285 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.