DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and AT1G62130

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_176404.3 Gene:AT1G62130 / 842509 AraportID:AT1G62130 Length:1043 Species:Arabidopsis thaliana


Alignment Length:278 Identity:105/278 - (37%)
Similarity:169/278 - (60%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLP 116
            ::.:::.||.:..:..|::             |.::.|::|.|::.||..|::|...|:|.|:||
plant   721 EIESKKSLKDIVTENTFEI-------------SDIIPPSEIGVTFDDIGALENVKDTLKELVMLP 772

  Fly   117 IQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTS 181
            .|..:||...:|.:...|:||.||.|.|||::|||.|.|||...||:.::    :|:.|.:|...
plant   773 FQWPELFCKGQLTKPCNGILLFGPSGTGKTMLAKAVATEAGANLINMSMS----RWFSEGEKYVK 833

  Fly   182 AVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRP 246
            |||||||:|.|.|||:||::|.|       |......|.:|::.||||.||....|:|:.|||||
plant   834 AVFSLASKISPSIIFLDEVESML-------HRYRLKTKNEFIINWDGLRTNEKERVLVLAATNRP 891

  Fly   247 QDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRN 311
            .|||:|::||:|.:..:|||....|..|||:||..|::|.|.|::.::.:|||:||:||:.:|..
plant   892 FDLDEAVIRRLPHRLMVGLPDARSRSKILKVILSKEDLSPDFDIDEVASMTNGYSGNDLKNLCVT 956

  Fly   312 ASVYRMRQLI----TSRD 325
            |:..|:.:::    :.||
plant   957 AARRRIIEIVEKEKSERD 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 61/133 (46%)
AAA 135..265 CDD:278434 59/129 (46%)
AT1G62130NP_176404.3 P-loop_NTPase 749..>816 CDD:304359 30/66 (45%)
AAA 789..912 CDD:214640 62/133 (47%)
AAA 791..910 CDD:278434 59/129 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1430018at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.