DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and AT4G02480

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_567238.2 Gene:AT4G02480 / 827979 AraportID:AT4G02480 Length:1265 Species:Arabidopsis thaliana


Alignment Length:345 Identity:133/345 - (38%)
Similarity:204/345 - (59%) Gaps:27/345 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADI 92
            :|:..|:.:.:..:.......|..|    :.||.:..:          :::|..:.|.::.|:||
plant   908 VISAESISYGLQTLHDIQNENKSLK----KSLKDVVTE----------NEFEKKLLSDVIPPSDI 958

  Fly    93 TVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAG 157
            .||:.||..|::|.:.|:|.|:||:|..:||...:|.:..||:||.||||.|||::|||.|.|||
plant   959 GVSFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAG 1023

  Fly   158 MRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFL-RSRNMNDHEATAMMKTQ 221
            ..|||:.::.:|.||:||.:|...|||||||:|.|.:||:||:||.| |..|..:|||...||.:
plant  1024 ANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNE 1088

  Fly   222 FMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQ 286
            ||:.||||.|.....|:|:.|||||.|||:|::||:|.:..:.||..|.|..||.:||..||::.
plant  1089 FMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEEIAP 1153

  Fly   287 DVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNN-----------VR-IT 339
            ||||..::.:|:|:|||||:.:|..|:.:.:|:::.......||....|           || :|
plant  1154 DVDLEAIANMTDGYSGSDLKNLCVTAAHFPIREILEKEKKEKTAAQAENRPTPPLYSCTDVRSLT 1218

  Fly   340 MDDLLGSHLKIKESKMHTSS 359
            |:|...:|.::..|....||
plant  1219 MNDFKAAHDQVCASVSSDSS 1238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 71/134 (53%)
AAA 135..265 CDD:278434 69/130 (53%)
AT4G02480NP_567238.2 AAA 999..1134 CDD:214640 72/134 (54%)
AAA 1001..1132 CDD:278434 69/130 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1430018at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1165
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.