DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Trip13

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_081458.1 Gene:Trip13 / 69716 MGIID:1916966 Length:432 Species:Mus musculus


Alignment Length:360 Identity:88/360 - (24%)
Similarity:145/360 - (40%) Gaps:101/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIA 100
            :.:|:..|:|:|      |.||                   ...::.|||.|:||      |:..
Mouse   100 FQLNEEGPSSEN------LDEE-------------------TENIIAASHWVLPA------AEFH 133

  Fly   101 GL-DSVIQE------LRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGM 158
            || ||::.:      |.:.|:..:...|....|.|....:.||||||||.|||.:.||.|::..:
Mouse   134 GLWDSLVYDVEVKSHLLDYVMTTVLFSDKNVDSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTI 198

  Fly   159 R---------FINLDVAILTDKWYGESQKLTSAVFSLASRIEPCI--------IFIDEIDSFLRS 206
            |         .|.::...|..||:.||.||.:.:|   .:|:..|        :.|||::|...:
Mouse   199 RLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMF---QKIQDLIDDKEALVFVLIDEVESLTAA 260

  Fly   207 RN-----MNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLP 266
            ||     ....:|..::......: |.:..::|  |:::..:|..:.:|.|.|.|...:.:||.|
Mouse   261 RNACRAGAEPSDAIRVVNAVLTQI-DQIKRHSN--VVILTTSNITEKIDVAFVDRADIKQYIGPP 322

  Fly   267 SETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATAL 331
            |...   |.|:.|                       |.|.|:.:...:|..:||:|.|:......
Mouse   323 SAAA---IFKIYL-----------------------SCLEELMKCQIIYPRQQLLTLRELEMIGF 361

  Fly   332 DRNNVRITMDDLLGSHLKIKESKMHTSSLFLENRI 366
            ..|||         |.|.:..|::...|..|..|:
Mouse   362 IENNV---------SKLSLLLSEISRKSEGLSGRV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 43/155 (28%)
AAA 135..265 CDD:278434 42/151 (28%)
Trip13NP_081458.1 AAA 172..322 CDD:214640 43/155 (28%)
AAA 175..320 CDD:278434 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.