DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Spata5l1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001103117.1 Gene:Spata5l1 / 691729 RGDID:1595990 Length:747 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:140/278 - (50%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATA 153
            |.::|     :.||......|||.:.||:.:........| ..|:||||.||||.|||.:.:|.|
  Rat   190 PGEVT-----LGGLSETADSLRELLRLPLCYPLALAALGL-AVPRGVLLAGPPGVGKTQLVRAVA 248

  Fly   154 KEAGMRFINLDVAILTDKWYGESQKLTSAVF----SLASRIEPCIIFIDEIDSFLRSRNMNDHEA 214
            :|||...:.:....|.....||:::....||    .|||| .|.::|:||:|:....|.......
  Rat   249 REAGAELLAVSAPALQGTRPGETEENVRRVFQRAQELASR-GPSLLFLDEVDALCPRRGGPQRAP 312

  Fly   215 TAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFH----IGLPSETQRKDIL 275
            .:.:..|.:.|.||:  :.:..|:|:||||||.:||.|:  |.|.:|.    ||.|:..||:.||
  Rat   313 ESRVVAQVLTLLDGI--HGDREVVVVGATNRPDELDPAL--RRPGRFDREVIIGTPTLKQREAIL 373

  Fly   276 KLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITM 340
            .:|.....:|..:||..|:::|.|:.|:||..:||.|:...:.:         ...::||.:|..
  Rat   374 GVITSKMPISSHIDLGLLAEMTVGYVGADLTALCREAATCALLK---------NEKNQNNPKIEE 429

  Fly   341 DDLLGSHLKIKESKMHTS 358
            .|.|.:..|::.|...:|
  Rat   430 TDFLEAFKKVQPSSFRSS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 52/141 (37%)
AAA 135..265 CDD:278434 49/137 (36%)
Spata5l1NP_001103117.1 CDC48 14..738 CDD:273521 88/278 (32%)
AAA 230..362 CDD:278434 48/136 (35%)
AAA 496..646 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.