DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Fignl1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_011242039.1 Gene:Fignl1 / 60530 MGIID:1890648 Length:692 Species:Mus musculus


Alignment Length:293 Identity:103/293 - (35%)
Similarity:168/293 - (57%) Gaps:26/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NQMDPTSKNKKKAKV----------LAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADIT 93
            |:.|.:.::.||.|.          |.::.||.: |....:|...|..|:            ...
Mouse   364 NKQDGSEQHAKKHKSSRAGSAEPAHLTDDCLKNV-EPRMVELIMNEIMDH------------GPP 415

  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGM 158
            |.|.||||::.....::|.||.|:...|:|  :.|...|||:||.||||.|||||.|..|.::|.
Mouse   416 VHWDDIAGVEFAKATIKEIVVWPMMRPDIF--TGLRGPPKGILLFGPPGTGKTLIGKCIASQSGA 478

  Fly   159 RFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFM 223
            .|.::..:.||.||.||.:|:..|:|::|...:|.:||||||||.|..|...:||::..:||:|:
Mouse   479 TFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFL 543

  Fly   224 MLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVS-QD 287
            :..||.:|::...::|:|||||||::|:|..||:..:.:|.||..:.||.|:..::..|:.. .|
Mouse   544 VQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSD 608

  Fly   288 VDLNRLSKLTNGFSGSDLREMCRNASVYRMRQL 320
            .:.:.:.:.::||||:|:.::||.||:..:|.|
Mouse   609 EETDLVVQQSDGFSGADMTQLCREASLGPIRSL 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 60/133 (45%)
AAA 135..265 CDD:278434 57/129 (44%)
Fignl1XP_011242039.1 RecA-like_Figl-1 398..583 CDD:410933 76/198 (38%)
AAA_lid_3 608..>639 CDD:407720 10/30 (33%)
Vps4_C <649..689 CDD:401324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.