DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Fign

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_068362.1 Gene:Fign / 60344 MGIID:1890647 Length:759 Species:Mus musculus


Alignment Length:313 Identity:94/313 - (30%)
Similarity:161/313 - (51%) Gaps:27/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELM-IASHLVVPADITVSWADIAGLDSVIQ 107
            ||.|..     .:||||.              :|..|: :.::.::.....|.|:||||||.|..
Mouse   451 TSSNHS-----VDEQLKN--------------TDTHLIDLVTNEIITQGPPVDWSDIAGLDLVKA 496

  Fly   108 ELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKW 172
            .::|.|:.|:...|.|  |.|...|:.:||.||.|.||||:.:..|.:.|..|..:..:.|..||
Mouse   497 VIKEEVLWPVLRSDAF--SGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKIAGSGLVAKW 559

  Fly   173 YGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNANSTV 237
            .||::|:..|.|.:|...:|.:||:.:||..|.|:...:|...:.|:|:|:|..|.:.|:|...:
Mouse   560 IGEAEKIIHASFLVARCRQPSVIFVSDIDMLLSSQVSEEHSPVSRMRTEFLMQLDTVLTSAEDQI 624

  Fly   238 IVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDIL-KLILQSEEVSQDVDLNRLSKLTNGFS 301
            :|:.||::|:::|:::.|....:..|.||..|.|..|: :|:.|......|.:...|.:.|.|||
Mouse   625 VVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLTQHNYCLNDKEFALLVQRTEGFS 689

  Fly   302 GSDLREMCRNASVYRMRQLITSRDPSATALDRNNVR-ITMDDLLGSHLKIKES 353
            |.|:..:|:.|:|..:..:..:   ..:|:..:.:| :|..|...:..||:.|
Mouse   690 GLDVAHLCQEAAVGPLHAMPAT---DLSAIMPSQLRPVTYQDFENAFCKIQPS 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 44/133 (33%)
AAA 135..265 CDD:278434 43/129 (33%)
FignNP_068362.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..293
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..429
26Sp45 389..736 CDD:130309 91/308 (30%)
AAA 522..652 CDD:278434 43/129 (33%)
Vps4_C <723..756 CDD:286426 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.