DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and zgc:136908

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001035017.1 Gene:zgc:136908 / 563679 ZFINID:ZDB-GENE-060312-22 Length:805 Species:Danio rerio


Alignment Length:318 Identity:108/318 - (33%)
Similarity:157/318 - (49%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADIT 93
            :|....||.::|.:|::..:...:|                              .|        
Zfish   449 VTMDDFKWALSQSNPSALRETVVEV------------------------------PH-------- 475

  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAP-KGVLLHGPPGCGKTLIAKATAKEAG 157
            |:|.||.|||.|.:||:|.|..|:::.|  |..|....| :|||.:|||||||||:|||.|.|..
Zfish   476 VNWEDIGGLDEVKRELQELVQYPVEYPD--KFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQ 538

  Fly   158 MRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHE---ATAMMK 219
            ..|:::....|...|:|||:.....||..|.:..|||:|.||:||..::|.....:   |...:.
Zfish   539 ANFVSIKGPELLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKARGGGAGDAGGAADRVI 603

  Fly   220 TQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSE 282
            .|.:...||::...|  |.::||||||..:|.||:|  |:....:|.||....|..||:..|:..
Zfish   604 NQILTEMDGMTNKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDMPSRTAILRANLRKS 666

  Fly   283 EVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLI-----TSRDPSA---TALD 332
            .|::||||..|||:|.||||:||.|:|:.|....:|:.|     ..|...|   ||:|
Zfish   667 PVAKDVDLMYLSKITEGFSGADLTEICQRACKLAIREAIEAEIRAERQRQARKETAMD 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 54/139 (39%)
AAA 135..265 CDD:278434 52/134 (39%)
zgc:136908NP_001035017.1 CDC48 27..766 CDD:273521 108/318 (34%)
CDC48_N 27..109 CDD:280513
CDC48_2 133..193 CDD:215011
AAA 243..372 CDD:278434
AAA 516..649 CDD:278434 52/134 (39%)
Vps4_C <731..762 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.