DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and nsfb

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001019625.2 Gene:nsfb / 554200 ZFINID:ZDB-GENE-050808-1 Length:747 Species:Danio rerio


Alignment Length:374 Identity:99/374 - (26%)
Similarity:161/374 - (43%) Gaps:86/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MDP--------TSKNKK--------KAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVP 89
            |||        :||..|        .::|:.|:     ||.....|.|:.    :...:...::.
Zfish   155 MDPSILRGEQNSSKKHKIDIGLLHGNSQVIFEK-----AESSSVNLIGKA----KTKGSRQSIIN 210

  Fly    90 ADITVSWADIAGLDSVIQEL-RESVVLPIQHKDLF-----KHSKLWQAPKGVLLHGPPGCGKTLI 148
            .|.......|.|||....:: |.:....:...|:.     ||      .||:||:|||||||||:
Zfish   211 PDWNFERMGIGGLDKEFSDIFRRAFASRVFPPDIVEQMGCKH------VKGILLYGPPGCGKTLM 269

  Fly   149 AKATAKEAGMR---FINLDVAILTDKWYGESQKLTSAVFS--------LASRIEPCIIFIDEIDS 202
            |:...|....|   .:| ...|| :|:.|||:.....:|:        |.:.....||..||||:
Zfish   270 ARQIGKMLNAREPKVVN-GPEIL-NKYVGESEANIRKLFADAEEEQKRLGANSGLHIIIFDEIDA 332

  Fly   203 FLRSR-----NMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQ 260
            ..:.|     :...|:...   .|.:...||:....|  ::|:|.||||..:|:|::|  |:..:
Zfish   333 ICKQRGSMAGSTGVHDTVV---NQLLSKIDGVEQLNN--ILVIGMTNRPDLIDEALLRPGRLEVK 392

  Fly   261 FHIGLPSETQRKDILKL----ILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLI 321
            ..||||.||.|..||.:    :.||..:::|||:..|:..|..:||::|..:.|.|         
Zfish   393 MEIGLPDETGRVQILNIHTAKMKQSNMLAKDVDVKELAVETKNYSGAELEGLVRAA--------- 448

  Fly   322 TSRDPSATALDRN---NVRITMDDLLGSHLKIKESKMHTSSLFLENRIE 367
                 .:||::|:   ..::.:|......|::..|....|   |.|.|:
Zfish   449 -----QSTAMNRHIKATTQVEVDTEKAQTLQVSRSDFLAS---LNNDIK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 49/151 (32%)
AAA 135..265 CDD:278434 46/147 (31%)
nsfbNP_001019625.2 CDC48_N 5..85 CDD:308138
CDC48_2 111..183 CDD:215011 6/27 (22%)
SpoVK <220..490 CDD:223540 86/300 (29%)
AAA 538..670 CDD:214640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.