DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and fign

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_021334341.1 Gene:fign / 553599 ZFINID:ZDB-GENE-050522-339 Length:747 Species:Danio rerio


Alignment Length:263 Identity:79/263 - (30%)
Similarity:141/263 - (53%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AEEQLKRLAEQEGFKLRGQEFSDYEL--MIASHLVVPADITVSWADIAGLDSVIQELRESVVLPI 117
            ||||||.              ||..|  |:.:.::.... .|.|:|||||:.....:::.|:.||
Zfish   446 AEEQLKN--------------SDASLVEMVTTEILQQTP-PVDWSDIAGLEMAKATIKDEVLWPI 495

  Fly   118 QHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSA 182
            ...|:|  |.|...|:.:||.||.|.|:||:.:..|.:.|..|:.|..:.|..||.||.:|:..|
Zfish   496 LRPDMF--SGLATLPRSILLFGPQGTGRTLLGRCMASQLGAAFLLLSGSALVTKWLGEGEKIVQA 558

  Fly   183 VFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQ 247
            .|.:|...:|.::||.::|..|.|: :::......:|::.::..||:.::....|:|:.:|::|:
Zfish   559 SFLIARCRQPSVVFISDVDLLLSSQ-LSEESPVNRIKSELLLQLDGVLSSPEEHVLVVCSTSKPE 622

  Fly   248 DLDKAIVRRMPAQFHIGLPSETQRKDIL-KLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRN 311
            ::|:::.|....:..:.||..|.|..|: :|:.|......|.::..|.:.|:||||.|:..:|:.
Zfish   623 EIDESLRRYFVKRLLVPLPDATARHQIISQLLSQHNYCLSDKEVTLLVQRTDGFSGLDVVRLCQE 687

  Fly   312 ASV 314
            |.|
Zfish   688 ALV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 37/133 (28%)
AAA 135..265 CDD:278434 36/129 (28%)
fignXP_021334341.1 EBV-NA3 <174..300 CDD:332796
Herpes_UL32 <270..>444 CDD:283680
SpoVK <464..734 CDD:223540 69/231 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.