DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and iqca1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_009300551.1 Gene:iqca1 / 553364 ZFINID:ZDB-GENE-050208-768 Length:845 Species:Danio rerio


Alignment Length:301 Identity:81/301 - (26%)
Similarity:142/301 - (47%) Gaps:30/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KNKKKAKVL-AEEQLKRLAEQ---EGFKLR--GQEFSDYELMIASHLVVPADITVSWADIAGLDS 104
            |.|||.|.| |:..::.|.|:   ||..:|  ..:.|||   |..:..:  ..|:..|||..:.|
Zfish   486 KKKKKEKDLTADRTIESLYEELVLEGIIIRPMNVKLSDY---IGEYSYL--GTTLRQADIEPMPS 545

  Fly   105 VIQELRESV----VLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDV 165
             :.::|:.:    :||:..:.:.:...|.:|   :||.||.|.||.::..|...|.|....||..
Zfish   546 -LSDVRQLIALYGILPLGSQCVHERGPLIRA---LLLTGPQGVGKKMLVHALCTETGANLFNLSP 606

  Fly   166 AILTDKWYGES--QKLTSAVFSLASRIEPCIIFIDEID-SFLRS--RNMNDHEATAMMKTQFMML 225
            :.|..|:.|:|  |.|...||.:|.:::|.:|:|.:.: :|.:.  :...:.|...:.||...:|
Zfish   607 STLAGKYPGKSGLQLLLHMVFKVARQLQPSVIWIGDAEKTFYKKVPKLEKEMEPKRLKKTLPKIL 671

  Fly   226 WDGLSTNANSTVIVMGATNRPQDLD-KAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQD-- 287
               .|..|...|:|:|.:.||.|.| |...:.......|..|....|..:.|.:||:.....|  
Zfish   672 ---KSIKAEDRVLVVGTSRRPFDADIKPFCKVYKKIILIPRPDYASRFTLWKELLQAHGALLDPK 733

  Fly   288 VDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSA 328
            :||:.|:|:|:|::...:.:..:...:....:|...|..:|
Zfish   734 LDLSSLAKVTDGYTQGHILQAIQTILIPHRLELQAKRPLTA 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 40/139 (29%)
AAA 135..265 CDD:278434 40/135 (30%)
iqca1XP_009300551.1 SpoVK <576..748 CDD:223540 52/174 (30%)
AAA 576..691 CDD:278434 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.