DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and spast

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_012818464.1 Gene:spast / 549207 XenbaseID:XB-GENE-947839 Length:603 Species:Xenopus tropicalis


Alignment Length:267 Identity:109/267 - (40%)
Similarity:170/267 - (63%) Gaps:7/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAP-KGVLLHGPPGCGKTLIAK 150
            :|.:..||.:|||||.|...|.|:|.|:||....:||...:   || :|:||.||||.|||::||
 Frog   319 IVDSGPTVKFADIAGQDLAKQALQEIVILPSIRPELFTGLR---APARGLLLFGPPGNGKTMLAK 380

  Fly   151 ATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEAT 215
            |.|.|:...|.|:..|.||.|:.||.:||..|:||:|..::|.||||||:||.|..|...:|:|:
 Frog   381 AVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCERREGEHDAS 445

  Fly   216 AMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQ 280
            ..:||:|::.:||:.:..:..|:|||||||||:||.|::||...:.::.||:|..|..:||.:|.
 Frog   446 RRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAVLRRFTKRVYVSLPNEETRLLLLKNLLS 510

  Fly   281 SE-EVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITMDDLL 344
            .: ....:.:|.:||:||.|:||||:..:.::|::..:|:|...:..:..|.:..|::.:  |.|
 Frog   511 KQGNPLNEKELTQLSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYS--DFL 573

  Fly   345 GSHLKIK 351
            .|..|||
 Frog   574 SSLKKIK 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 63/134 (47%)
AAA 135..265 CDD:278434 61/129 (47%)
spastXP_012818464.1 MIT_spastin 110..188 CDD:239142
SpoVK <278..584 CDD:223540 109/267 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.