DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Pex1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001102690.1 Gene:Pex1 / 500006 RGDID:1559939 Length:1283 Species:Rattus norvegicus


Alignment Length:413 Identity:104/413 - (25%)
Similarity:177/413 - (42%) Gaps:95/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSDLSK-----------------GQIFQVLVRLSVASLITYYSVKWMMNQMDPTSKNKKKAKVLA 55
            |.|:||                 .:.|.|||..::.|.::        .|.:||           
  Rat   758 GCDISKSPDLDLKCIAKETEAFVARDFTVLVDRAIHSSLS--------RQQNPT----------- 803

  Fly    56 EEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADI---------TVSWADIAGLDSVIQELRE 111
                     :||..|...:|..     |....:||.:         .:.|..|.||..|.|.|.:
  Rat   804 ---------REGLTLTTADFQK-----ALRGFLPASLRNVNLHKPRDLGWDKIGGLHEVRQILMD 854

  Fly   112 SVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGES 176
            ::.||.::.:||.:..:.|. .|:||:||||.||||:|...|:|:||.||::....|..|:.|.|
  Rat   855 TIQLPAKYPELFANLPIRQR-TGILLYGPPGTGKTLLAGVVARESGMNFISIQGPELLSKYIGAS 918

  Fly   177 QKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMG 241
            ::....||..|...:|||:|.||.:|....|..::...|..:..|.:...||:  .....|.|:.
  Rat   919 EQAVRDVFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGV--EGLQGVYVLA 981

  Fly   242 ATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSD 304
            ||:||..:|.|::|  |:....:...|.:..|.:||.::.:|..::.||||..::.:|..|:|:|
  Rat   982 ATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILTVLSKSLPLADDVDLQHVASVTESFTGAD 1046

  Fly   305 LREMCRNASVYRMRQLI---------------------------TSRDPSA----TALDRNNVRI 338
            |:.:..||.:..::..:                           :..|.||    ..||::.|.:
  Rat  1047 LKALLYNAQLEALQGRLLPGGLHDGGSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSL 1111

  Fly   339 TMDDLLGSHLKIKESKMHTSSLF 361
            .|.::|....|....:::..|.:
  Rat  1112 EMSEILPDESKFNMYRLYFGSSY 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 47/135 (35%)
AAA 135..265 CDD:278434 46/131 (35%)
Pex1NP_001102690.1 PEX-2N 19..98 CDD:286362
PEX-1N 104..179 CDD:286361
AAA 591..741 CDD:214640
AAA 595..724 CDD:278434
AAA 877..1009 CDD:214640 46/133 (35%)
AAA 877..1006 CDD:278434 46/130 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.