DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and NVL

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_016856867.1 Gene:NVL / 4931 HGNCID:8070 Length:917 Species:Homo sapiens


Alignment Length:352 Identity:109/352 - (30%)
Similarity:181/352 - (51%) Gaps:52/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPTSKNKKKAK----------VLAEEQLKRLAEQEGFKLRGQEFSDYELMIAS---------HLV 87
            :|||:.:.:.:          .|:|||::.|.         .|.:|:.:.::|         .:.
Human   580 EPTSETQDELQRLLGLLRDQDPLSEEQMQGLC---------IELNDFIVALSSVQPSAKREGFVT 635

  Fly    88 VPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKAT 152
            ||   .|:||||..|:.:.:||..:::.|:::.|.||...| ..|.||||.|||||||||:|||.
Human   636 VP---NVTWADIGALEDIREELTMAILAPVRNPDQFKALGL-VTPAGVLLAGPPGCGKTLLAKAV 696

  Fly   153 AKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAM 217
            |.|:|:.||::....|.:.:.|||::....||..|....||:||.||:|:....|:..:..|:..
Human   697 ANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVR 761

  Fly   218 MKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQ 280
            :..|.:...|||  .|...|.:|.|||||..:|.||:|  |:.....:|||....|..|||.|.:
Human   762 VVNQLLTEMDGL--EARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITK 824

  Fly   281 S---EEVSQDVDLNRLS--KLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITM 340
            :   ..:..||:|..::  ...:.::|:||..:.|.||:..:||.: :|..|..  ::..:::  
Human   825 NGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEM-ARQKSGN--EKGELKV-- 884

  Fly   341 DDLLGSHLKIKES-KMHTSSLFLENRI 366
                 ||...:|: |...||:..:::|
Human   885 -----SHKHFEEAFKKVRSSISKKDQI 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 56/135 (41%)
AAA 135..265 CDD:278434 53/131 (40%)
NVLXP_016856867.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.