DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Pex1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_652016.1 Gene:Pex1 / 45460 FlyBaseID:FBgn0013563 Length:1006 Species:Drosophila melanogaster


Alignment Length:302 Identity:79/302 - (26%)
Similarity:135/302 - (44%) Gaps:48/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFIN 162
            ::.||:||:..|.|.::.|.::..:|..|.| :...||||:||||.|||.:....|....:|.|:
  Fly   721 ELPGLESVVGVLEEVLMWPSRYPTIFNASPL-RNQAGVLLYGPPGTGKTYLVSQLATSWNLRIIS 784

  Fly   163 LDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWD 227
            :....|..|:.|:|::....:|:.|....||::|.||.||....|..:....|..:..|.:...|
  Fly   785 VKGPELLAKYIGQSEENVRNLFNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELD 849

  Fly   228 GLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDL 290
            |:......|||  .||:||:.||.|::|  |:.......||....|..|.:.:..:..:.:.||.
  Fly   850 GVEGLQGVTVI--AATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTLSLDECVDF 912

  Fly   291 NRLSKLTNGFSGSDLREMCRNASVYRMRQLI------------------------TSRDPSATAL 331
            :..:..|..::|:|::.:..:|::..:::.:                        |:| ||.:|.
  Fly   913 DWFAGKTANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTR-PSLSAS 976

  Fly   332 D-----RNNVRITMDDLLGSHLKIKESKMHTSSLFLENRIEL 368
            |     |...|.|             :|..||..|:..|..|
  Fly   977 DVAKYHRTYARFT-------------NKEKTSREFVAKRATL 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 44/135 (33%)
AAA 135..265 CDD:278434 43/131 (33%)
Pex1NP_652016.1 PEX-1N 93..168 CDD:286361
SpoVK 479..974 CDD:223540 68/256 (27%)
P-loop_NTPase 480..604 CDD:304359
AAA 757..887 CDD:278434 43/131 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.