DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and vcp

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001005677.1 Gene:vcp / 448177 XenbaseID:XB-GENE-969573 Length:805 Species:Xenopus tropicalis


Alignment Length:322 Identity:113/322 - (35%)
Similarity:168/322 - (52%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADIT 93
            :|....:|.::|.:|::        |.|..::                           ||   .
 Frog   447 VTMDDFRWALSQSNPSA--------LRETVVE---------------------------VP---Q 473

  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAP-KGVLLHGPPGCGKTLIAKATAKEAG 157
            |:|.||.||:.|.:||:|.|..|::|.|  |..|....| ||||.:|||||||||:|||.|.|..
 Frog   474 VTWEDIGGLEDVKRELQELVQYPVEHPD--KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQ 536

  Fly   158 MRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSR--NMNDHEATA-MMK 219
            ..||::....|...|:|||:.....:|..|.:..||::|.||:||..::|  |:.|....| .:.
 Frog   537 ANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVI 601

  Fly   220 TQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSE 282
            .|.:...||:||..|  |.::||||||..:|.||:|  |:....:|.||.|..|..|||..|:..
 Frog   602 NQILTEMDGMSTKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKS 664

  Fly   283 EVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSR---------DPSATALDRNN 335
            .|::||||:.|:|:||||||:||.|:|:.|....:|:.|.:.         :|||..::.::
 Frog   665 PVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDD 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 58/139 (42%)
AAA 135..265 CDD:278434 55/134 (41%)
vcpNP_001005677.1 CDC48 25..764 CDD:273521 113/322 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..805
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.