DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and pch2

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster


Alignment Length:339 Identity:86/339 - (25%)
Similarity:161/339 - (47%) Gaps:62/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GQEFSD--YELMIASHLVVPADITVS-WADI---AGLDSVIQELRESVVLPIQHK---DLFKHSK 127
            |:|.||  ..::.|||.::||...|. |.::   .||...:.:...|.::..:|:   ::...::
  Fly   103 GEEGSDGIDSIVAASHALLPAAQFVGLWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNR 167

  Fly   128 LWQAPKGVLLHGPPGCGKTLIAKATAKEAGMR---------FINLDVAILTDKWYGESQKLTSAV 183
            |      :|||||||.|||.:.||.|::..:|         .:.::...|..||:.||.||.:.:
  Fly   168 L------ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQL 226

  Fly   184 FSLASRI--EP----CIIFIDEIDSFLRSRN-MNDHEATAMMKTQFMML--WDGLSTNANSTVIV 239
            |:..:.:  :|    |:: |||::|...:|: |:.:|....|:....:|  .|.|.|..|  |::
  Fly   227 FNKIAELVSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPN--VLI 288

  Fly   240 MGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILK--------------LILQSEEVSQDVDL 290
            :..:|..|.:|.|.|.|...:..||.|..:..::|.|              .:|:||:..:.: |
  Fly   289 LATSNLAQSIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGL-L 352

  Fly   291 NRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITMDDLLGSHLKIKESKM 355
            .:|::.:.|.||..||::          .|:.....:::.|...:.:|::.|.|.:.|:..|..:
  Fly   353 TQLAERSVGLSGRTLRKL----------PLLAHAQYTSSTLFELDQKISLSDFLDAMLEALEQHL 407

  Fly   356 HTSSLF-LENRIEL 368
            ....|. ||:..:|
  Fly   408 GEQRLLKLESMEQL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 46/151 (30%)
AAA 135..265 CDD:278434 45/147 (31%)
pch2NP_001287235.1 AAA 166..315 CDD:214640 47/157 (30%)
AAA 169..314 CDD:278434 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.