DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and kat-60L1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:301 Identity:113/301 - (37%)
Similarity:168/301 - (55%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KLRGQEFS--DYELMIASHLV--VPADI-----TVSWADIAGLDSVIQELRESVVLPIQHKDLFK 124
            |.:.:.||  .||:    |||  :..||     .:.|.|:|||:.....|:|:||||:...:.||
  Fly   361 KTKAKHFSPLGYEV----HLVDTLEKDILQRHPCIKWTDVAGLNEAKTILQEAVVLPVIMPEFFK 421

  Fly   125 H-SKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLAS 188
            . .:.|   :|||:.||||.|||::|||.|.|.|..|.|:..:.||.|:.|||:||...:|.:|.
  Fly   422 GIRRPW---RGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMAR 483

  Fly   189 RIEPCIIFIDEIDSFLRSRNM-NDHEATAMMKTQFMMLWDGL--STNANSTVIVMGATNRPQDLD 250
            ...|..|||||||:...||.. ::|||:...|.:.::..|||  |......::|:.|||.|.|:|
  Fly   484 FYAPSTIFIDEIDALCASRGSDSEHEASRRFKAELLIQMDGLNASMQEEKVIMVLAATNHPWDID 548

  Fly   251 KAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVY 315
            :|..||...:.:|.||:|..|..:|||.|:...:|..::...:.....|:||||:..:||:||:.
  Fly   549 EAFRRRFEKRIYIPLPNEGTRSALLKLCLKDVCLSPSLNTGIIGDELQGYSGSDISNVCRDASMM 613

  Fly   316 RMRQLITSRDP-SATALDRNNV--RITMDDLLGSHLKIKES 353
            .||:||:.|.| ....:.|..|  .||:.|...:.|:.|:|
  Fly   614 AMRRLISGRTPDQIKQIRREEVDQPITLQDFQDARLRTKKS 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 57/136 (42%)
AAA 135..265 CDD:278434 56/132 (42%)
kat-60L1NP_001163523.1 AAA 426..565 CDD:214640 59/141 (42%)
AAA 430..563 CDD:278434 56/132 (42%)
Vps4_C <638..671 CDD:286426 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.