DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and CG14183

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster


Alignment Length:384 Identity:76/384 - (19%)
Similarity:142/384 - (36%) Gaps:106/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YSVKWMMNQMDPTSKNKKKAKV-LAEEQLKRLAEQEGFKLRG--QEFS--DYELMIASHLVVPAD 91
            ||..| .|..:..:||....|. :.||||.::.::    :||  .|:.  :||| :...|....|
  Fly   460 YSKDW-RNVDEYLNKNHDPIKEWVTEEQLAKIHQE----VRGLVDEYMRVEYEL-LREALAKDND 518

  Fly    92 -----ITVSW------------ADIAG---LDSVIQELRES-VVLPIQHKD-------------- 121
                 :.|.:            .|:.|   |:|:..||::: ::..|.|:|              
  Fly   519 EKYKALKVKYPKKKKEKRKKKPKDMTGDRTLESLYNELKDAGIIEEIGHRDFDEFITDFNFVADD 583

  Fly   122 -------------------LFKHSKLWQA------PKGVLLHGPPGCGKTLIAKATAKEAGMRFI 161
                               :.:.|.|...      ||.:||.||...||.|:.:..|.|....|:
  Fly   584 TRDEDGLTTLGPAKGDIKMVIQESMLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFM 648

  Fly   162 NLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSF-----------LRSRNMNDHEAT 215
            ||... .|.|:..:.:.....:..:|...:|.|::|:|....           :..|.:....|:
  Fly   649 NLSPE-NTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLAS 712

  Fly   216 AMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPS-ETQRKDILKLIL 279
            .::|          ....|..::::|.:|.|...:..|.|..  |..:.:|. :.....:|.|.|
  Fly   713 KILK----------PLKKNDKIVLVGTSNMPWAANGGIKRAF--QKVLLIPKCDYGTSFLLWLEL 765

  Fly   280 QSEEVSQDVD---LNRLSKLTNGFSGSDLREMCRNA-SVYRMRQLITSRDPSATALDRN 334
            .:|....|:.   .:.|:::...::..|:.:..:.. ::.|..:|      ...|||.|
  Fly   766 MTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKETLNIDRKMRL------KNEALDPN 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 31/144 (22%)
AAA 135..265 CDD:278434 29/140 (21%)
CG14183NP_649172.3 AAA 622..751 CDD:278434 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.