DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and trip13

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_012819902.1 Gene:trip13 / 394836 XenbaseID:XB-GENE-974898 Length:440 Species:Xenopus tropicalis


Alignment Length:346 Identity:84/346 - (24%)
Similarity:146/346 - (42%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KAKVLAE-EQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGL-DSVI--QELR 110
            |.|||.. .||    .::|..:...|..:.:|:.|:|.::||      ||..|| ||:|  .|::
 Frog   100 KCKVLIHIFQL----NEDGPCVESLEEENEDLVAANHWLLPA------ADFHGLWDSLIYDSEIK 154

  Fly   111 ESVVLPIQHKDLFKHSKL------WQAPKGVLLHGPPGCGKTLIAKATAKEAGMR---------F 160
            ..::..|:...||....:      |.  :.||||||||.|||.:.||.|::..:|         .
 Frog   155 SRLLDYIETAMLFSDKNVDSNLISWN--RVVLLHGPPGTGKTSLCKALAQKLTIRLSYRYRYGQL 217

  Fly   161 INLDVAILTDKWYGESQKLTSAVFSLASRI---EPCIIF--IDEIDSFLRSRNMN-----DHEAT 215
            :.::...|..||:.||.||.:.:|.....:   :..::|  |||::|...:|..:     ..:|.
 Frog   218 VEINSHSLFSKWFSESGKLVTKMFQKIHELINDKEALVFVLIDEVESLTAARKASRAGTEPSDAI 282

  Fly   216 AMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQ 280
            .::......: |.:....|  |:::..:|..:.:|.|...|...:.:||.||...   |.|:.| 
 Frog   283 RVVNAVLTQI-DHIKRYPN--VVILSTSNLTEKIDVAFTDRADIKQYIGPPSPAA---IFKIYL- 340

  Fly   281 SEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITMDDLLG 345
                                  |.:.|:.:...:|..:||:|.||........||:         
 Frog   341 ----------------------SCIEELMKCQIIYPKQQLLTLRDLEIIGFLENNI--------- 374

  Fly   346 SHLKIKESKMHTSSLFLENRI 366
            |.|.::.:::...|..|..|:
 Frog   375 SKLSLQLNEISRKSEGLSGRV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 39/152 (26%)
AAA 135..265 CDD:278434 38/148 (26%)
trip13XP_012819902.1 SpoVK <144..394 CDD:223540 66/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.