DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and smid

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster


Alignment Length:288 Identity:96/288 - (33%)
Similarity:155/288 - (53%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSK 127
            |::|||                 :.|| |.|  |.||..|:.:.:||:.:|:.|:::.::.:...
  Fly   648 AKREGF-----------------ITVP-DTT--WDDIGALEKIREELKLAVLAPVKYPEMLERLG 692

  Fly   128 LWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEP 192
            | .||.||||.|||||||||:|||.|.|||:.||::....|.:.:.|||::...|.|..|....|
  Fly   693 L-TAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAP 756

  Fly   193 CIIFIDEIDSFL--RSRNMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR 255
            |:||.||.||..  ||...:.:.:...:..|.:...||:.....  |.::.|||||..:|.||:|
  Fly   757 CVIFFDEFDSLCPKRSDGGDGNNSGTRIVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILR 819

  Fly   256 --RMPAQFHIGLPSETQRKDILKLILQSEE---VSQDVDLNRLSKLTNGFSGSDLREMCRNASVY 315
              |:....::|.|.:::|.:|||...::.:   ::.||||:.::..|.|::|:||..:.:.||::
  Fly   820 PGRLDTILYVGFPEQSERTEILKATTKNGKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMF 884

  Fly   316 RMRQLITSRDPSATALDRNNVRITMDDL 343
            .:||.:            ||....:|||
  Fly   885 SLRQSL------------NNGDTNLDDL 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 55/137 (40%)
AAA 135..265 CDD:278434 52/133 (39%)
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 96/288 (33%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 19/37 (51%)
AAA 699..830 CDD:278434 52/132 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.