DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Pex6

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001027403.2 Gene:Pex6 / 3772165 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster


Alignment Length:293 Identity:91/293 - (31%)
Similarity:151/293 - (51%) Gaps:17/293 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLF-KHSKLWQAPKGVL 136
            :..:|.:...|..|..|....|.|:||.||..:..|::.|:.||::|..|. |:.:    ..|:|
  Fly   594 KNLTDMQSSFADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPLKHVHLMGKNLR----RSGIL 654

  Fly   137 LHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEID 201
            |:||||.||||:|||.|.|..:.|:::....|.:.:.|:|::....|||.|....||::|:||:|
  Fly   655 LYGPPGTGKTLVAKAVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSAAPCVLFLDELD 719

  Fly   202 SFLRSRNMNDHEATAM--MKTQFMMLWDGLST-NANSTVIVMGATNRPQDLDKAIVR--RMPAQF 261
            |...:|.:.......|  :.:|.:...||:|. :.:..:.::.|||||..:|.|::|  |....|
  Fly   720 SLAPNRGVAGDSGGVMDRVVSQLLAEMDGMSDGDTSKPIFILAATNRPDLIDPALLRPGRFDKLF 784

  Fly   262 HIGLPSETQRKDILKLILQSEEVSQD--VDLNRLS-KLTNGFSGSDLREMCRNASVYRMRQLI-- 321
            ::| |..|.......|..|::..:.|  ||:.::: :|.:..||:||..:|.||.:..:|:.|  
  Fly   785 YVG-PCSTAEDKAAVLRAQTQRFALDAGVDMEQIAERLKSEMSGADLYSICSNAWLSAVRRTIDG 848

  Fly   322 -TSRDPSATALDRNNVRITMDDLLGSHLKIKES 353
             .|...|...|...||.:..:|...|..|...|
  Fly   849 HLSGTISEKELVPENVIVQEEDFTKSFNKFVPS 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 48/138 (35%)
AAA 135..265 CDD:278434 46/134 (34%)
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 81/257 (32%)
P-loop_NTPase 367..492 CDD:304359
AAA 653..787 CDD:278434 46/133 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.