DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Spata5

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_008759154.1 Gene:Spata5 / 361935 RGDID:1310478 Length:893 Species:Rattus norvegicus


Alignment Length:275 Identity:93/275 - (33%)
Similarity:154/275 - (56%) Gaps:5/275 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGM 158
            |::..|.||:|.::.:||.:.||::..:|||...: .||:|:||:||||.|||:||:|.|.|.|.
  Rat   350 VTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGI-PAPRGLLLYGPPGTGKTMIARAVANEVGA 413

  Fly   159 RFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFM 223
            ....::...:..|:|||::.....:|:.|:...|.||||||:|:....|.....|....:....:
  Rat   414 YVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLL 478

  Fly   224 MLWDGL-STNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDIL-KLILQSEEV 284
            .|.||: |..:...|:|:|||||||.||.|:.|  |...:..||:|:...|.||| ||:.:...:
  Rat   479 TLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHL 543

  Fly   285 SQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITMDDLLGSHLK 349
            ....:|.||:...:|:.|:||:.:|..|.:|.:|:::..:.....:.....|:||::|.|.....
  Rat   544 LTKAELLRLANNAHGYVGADLKALCNEAGLYALRRVLRKQPNLPDSKVAGMVKITLNDFLQGMND 608

  Fly   350 IKESKMHTSSLFLEN 364
            |:.|.|...::.:.|
  Rat   609 IRPSAMREVAIDVPN 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 53/136 (39%)
AAA 135..265 CDD:278434 50/132 (38%)
Spata5XP_008759154.1 CDC48_N 64..132 CDD:304500
SpoVK 370..882 CDD:223540 86/255 (34%)
AAA 390..522 CDD:278434 49/131 (37%)
AAA 664..796 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.