DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and TER94

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster


Alignment Length:351 Identity:121/351 - (34%)
Similarity:186/351 - (52%) Gaps:37/351 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNFGLGGSDLSKGQIFQVLVRLSVASLITYYSVKWMMNQMD--PTSKNKKKAKVLAEEQLKRLA- 63
            ::.|..|:||              |||.:..:::.:..:||  ....:|..|:|||.     || 
  Fly   424 ESHGHVGADL--------------ASLCSEAALQQIREKMDLIDLEDDKIDAEVLAS-----LAV 469

  Fly    64 EQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKL 128
            ..|.|:....:.|...|. .:.:.||   ..:|.||.||:||.:||:|.|..|::|.|.|....:
  Fly   470 TMENFRYAMTKSSPSALR-ETVVEVP---NTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGM 530

  Fly   129 WQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPC 193
             |..:|||.:|||||||||:|||.|.|....||::....|...|:|||:.....:|..|....||
  Fly   531 -QPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPC 594

  Fly   194 IIFIDEIDSFLRSR--NMNDHEATA-MMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR 255
            ::|.||:||..::|  |:.|....| .:..|.:...||:....|  |.::||||||..:|.||:|
  Fly   595 VLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKN--VFIIGATNRPDIIDPAILR 657

  Fly   256 --RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMR 318
              |:....:|.||.:..|:.|||..|:...::::|||..::|:|.||||:||.|:|:.|....:|
  Fly   658 PGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIR 722

  Fly   319 QLITS--RDPSATALDRNNVRITMDD 342
            |.|.:  |.....|.::|:. :.||:
  Fly   723 QAIEAEIRREKERAENQNSA-MDMDE 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 54/138 (39%)
AAA 135..265 CDD:278434 53/134 (40%)
TER94NP_001097249.1 CDC48 47..787 CDD:273521 121/351 (34%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 53/134 (40%)
Vps4_C <741..783 CDD:286426 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.