DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Fign

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster


Alignment Length:395 Identity:124/395 - (31%)
Similarity:200/395 - (50%) Gaps:84/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSVASLITY---YSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGF---------------K 69
            |.|:|  ||   .:||.......|.|:|....|:.|::.....:.|.||               |
  Fly   107 LEVSS--TYPVQQAVKSRPEGQFPESRNNSTKKIDAQQYSSESSSQSGFGFRTAREQLIMDELKK 169

  Fly    70 LRGQEFSDYELM-----------------IASHLVVPA--------------------------- 90
            ...|..|:.:.:                 ::|:.|.|.                           
  Fly   170 KNRQATSEVDAVPTGMMNFRKKTLGGKRTVSSNFVSPVAQNDNSTSSRSSSIPPALAHLDSKMVD 234

  Fly    91 --------DI-TVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKT 146
                    |. .|:|.|||||:|......|::::|::..|||...:.  .|:||||.||||.|||
  Fly   235 HILGESMHDFKPVAWEDIAGLESAKSTFLEAIIMPLRRPDLFTGVRC--PPRGVLLFGPPGTGKT 297

  Fly   147 LIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMND 211
            ||||:.|.:|..:|.:::.:.||.||.|:::||...:|::|:..:|.||||||:||.|..|:.|:
  Fly   298 LIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANE 362

  Fly   212 HEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPS-ETQRKDIL 275
            :|:|..:|.:|::..||.::|....|:|:|||||||:||:|:.||...:.::.||: |.::|.|.
  Fly   363 NESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLPTREARQKIIE 427

  Fly   276 KLILQSEEVSQDVDLNR---LSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVR 337
            |||   .:|..::|:.:   |::||:|:||:|:..:||.||:..:|.|  :.|............
  Fly   428 KLI---HQVKHNLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSL--TPDQMEVIETHQLPA 487

  Fly   338 ITMDD 342
            :||||
  Fly   488 VTMDD 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 61/133 (46%)
AAA 135..265 CDD:278434 59/129 (46%)
FignNP_001259995.1 AAA 282..418 CDD:214640 62/135 (46%)
AAA 286..416 CDD:278434 59/129 (46%)
Vps4_C <480..520 CDD:286426 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.