powered by:
Protein Alignment nmd and si:dkey-195m11.8
DIOPT Version :9
Sequence 1: | NP_001285801.1 |
Gene: | nmd / 44021 |
FlyBaseID: | FBgn0005322 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003198869.1 |
Gene: | si:dkey-195m11.8 / 324372 |
ZFINID: | ZDB-GENE-030131-3092 |
Length: | 269 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 28/64 - (43%) |
Gaps: | 12/64 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 SKLTNGFSGSDLREMC-RNASVYRMRQLITSRDPSATALDRNNVRITMDDLLGSHLKIKESKMH 356
|:..||.||..:.|.| .:...||..:|.|..|..|.|..:: |||:..|::.:
Zfish 208 SERQNGDSGGSVNESCGTDIQSYRPERLSTLPDLEADAEGKS-----------SHLRPLETRSY 260
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
nmd | NP_001285801.1 |
AAA |
132..266 |
CDD:214640 |
|
AAA |
135..265 |
CDD:278434 |
|
si:dkey-195m11.8 | XP_003198869.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0464 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.