DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and CG10793

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:328 Identity:100/328 - (30%)
Similarity:166/328 - (50%) Gaps:44/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QLKRL------------AEQEGFKLRGQE--FSDYELMIASHLV----VPADITVSWADIAGLDS 104
            |:|::            .|.|...|.|.:  ||..|....:.||    :..:|.:.|:|:.|...
  Fly   149 QIKKMETATESNGQDNACEIEHVHLGGDDVLFSSLEWQSLAELVKTSILQENIKIKWSDVCGNQR 213

  Fly   105 VIQELRESVVLPIQHKDLFKHS-KLWQAPKGVLLHGPPGCGKTLIAKATAKE--AGMRFINLDVA 166
            .|:.::|:|:.||:...||.|. |.|   :.:|||||||.||||:|||...|  ..:.|.|:..:
  Fly   214 AIELIKEAVLTPIEFPQLFAHGLKPW---RSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITAS 275

  Fly   167 ILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRN-MNDHEATAMMKTQFMMLWDGLS 230
            |:..||.|||:|:...:|.:|::..|.:||.|||:|....|: ..|||::...|.:.:.|.||:.
  Fly   276 IMVSKWRGESEKILRVLFHMAAKRAPSVIFFDEIESLTSKRDRATDHESSKRFKNELLQLLDGME 340

  Fly   231 TNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSK 295
            .:.|. |.|:.:||.|.|:|:|.:||...:..:.||:..:|..::..:|.|........|.:|.:
  Fly   341 HSLNG-VFVLASTNLPWDIDEAFLRRFEKKLLVQLPNAAERSCLINRLLGSSISLNPRLLEQLVE 404

  Fly   296 LTNGFSGSDLREMCRNASVYRMR----------QLITSRDPSATALDRN------NVRITMDDLL 344
            :::.|:|.::|..|:..|::|:|          .|:....|:  |::.|      .||.....||
  Fly   405 ISDHFTGDEIRLACKEISMHRVRCATKIGDRSIGLLAKESPA--AIEANVEKAFRQVRPLGQKLL 467

  Fly   345 GSH 347
            ..|
  Fly   468 AKH 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 52/136 (38%)
AAA 135..265 CDD:278434 52/132 (39%)
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 26/56 (46%)
AAA 238..376 CDD:214640 54/141 (38%)
AAA 242..374 CDD:278434 52/132 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.