DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Trip13

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001011930.1 Gene:Trip13 / 292206 RGDID:1308516 Length:432 Species:Rattus norvegicus


Alignment Length:406 Identity:96/406 - (23%)
Similarity:158/406 - (38%) Gaps:95/406 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSDLSKGQIFQVLVRLSVASLITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQ------- 65
            ||...|..|.|.:.||.....|.:....|........::|.:...:: :.:||....|       
  Rat    30 GSTAKKEDIKQSVYRLLKRHNIVFGDYVWTEFDEPFLTRNVQSVSIV-DTELKAKDPQPIDLSAC 93

  Fly    66 -----------EGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGL-DSVIQE------LRES 112
                       ||......:.....::.|||.|:||      |:..|| ||::.:      |.:.
  Rat    94 TIALHIFQLNEEGPSSENLDEETENIIAASHWVLPA------AEFHGLWDSLVYDVEVKSHLLDY 152

  Fly   113 VVLPIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMR---------FINLDVAIL 168
            |:..:...|....|.|....:.||||||||.|||.:.||.|::..:|         .|.::...|
  Rat   153 VMTTLLFSDKNVDSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSL 217

  Fly   169 TDKWYGESQKLTSAVFSLASRIEPCI--------IFIDEIDSFLRSRN-----MNDHEATAMMKT 220
            ..||:.||.||.:.:|   .:|:..|        :.|||::|...:||     ....:|..::..
  Rat   218 FSKWFSESGKLVTKMF---QKIQDLIDDKEALVFVLIDEVESLTAARNACRAGAEPSDAIRVVNA 279

  Fly   221 QFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVS 285
            ....: |.:..::|  |:::..:|..:.:|.|.|.|...:.:||.||...   |.|:.|      
  Rat   280 VLTQI-DQIKRHSN--VVILTTSNITEKIDVAFVDRADIKQYIGPPSAAA---IFKIYL------ 332

  Fly   286 QDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDRNNVRITMDDLLGSHLKI 350
                             |.|.|:.:...:|..:||:|.|:........|||         |.|.:
  Rat   333 -----------------SCLEELMKCQIIYPRQQLLTLRELEMIGFIENNV---------SKLSL 371

  Fly   351 KESKMHTSSLFLENRI 366
            ..|::...|..|..|:
  Rat   372 LLSEISRKSEGLSGRV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 43/155 (28%)
AAA 135..265 CDD:278434 42/151 (28%)
Trip13NP_001011930.1 RecA-like_Pch2-like 121..319 CDD:410916 57/209 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.