DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Iqca1l

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_808344.3 Gene:Iqca1l / 231045 MGIID:3045319 Length:825 Species:Mus musculus


Alignment Length:372 Identity:81/372 - (21%)
Similarity:153/372 - (41%) Gaps:88/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAG----LDS 104
            :.|.||:..:..:..:..|.|              ||:|...:...|.:|:|  |..|    |.|
Mouse   477 SGKKKKEKDLTPDRSVDSLFE--------------ELVIIGLIKKSALVTLS--DYIGDCLYLGS 525

  Fly   105 VIQ-----------ELRESV----VLPIQHKDLFKHSKLWQAP--KGVLLHGPPGCGKTLIAKAT 152
            .:.           ::|:::    ||.:...|:  |:   .||  :.:||.||.|.||.::.:|.
Mouse   526 TLTLANKMPMPSLFDIRQNMALYGVLRLGSHDI--HT---MAPLVRSILLVGPSGMGKKMLVQAV 585

  Fly   153 AKEAGMRFINLDVAILTDKWYGE--SQKLTSAVFSLASRIEPCIIFIDEID-SFLR-----SRNM 209
            ..|.|....:|....|..|:.|:  :|.|...||.:|..::|.:|:|...: :|.:     .|.|
Mouse   586 CTETGANLFDLSPDNLMGKYPGKNGAQLLVHIVFKVARLLQPSVIWIGNTEKTFYKKVPKEERTM 650

  Fly   210 NDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLD-KAIVRRMPAQFHIGLPSETQRKD 273
            :...    :|...|.....||  ....|:::|.|.|||..: |.:.|.......|..|....|..
Mouse   651 DPKR----IKKDLMRATKQLS--PGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYV 709

  Fly   274 ILKLILQSE----EVSQDVDLNRLSKLTNGFSGSDLREMCRNA-SVYRMRQLI------------ 321
            :.|.:::|:    :::..:|::.|:::::|::.|.:.:..::. :..|:.|||            
Mouse   710 LWKRMIESQGRGVQLTSSLDVSALARVSDGYTPSHILQSIQSVLTERRLLQLIKKPLVASEFVGH 774

  Fly   322 -TSRDP-------------SATALDRNNVRITMDDLLGSHLKIKESK 354
             ...||             ..|.|.:.|::.|.|.|.....::.:.|
Mouse   775 LARLDPVYREEEESLKEWFFKTPLGKKNMKFTKDQLEAEEARLTKEK 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 39/144 (27%)
AAA 135..265 CDD:278434 38/138 (28%)
Iqca1lNP_808344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..487 3/9 (33%)
SpoVK <566..745 CDD:223540 46/184 (25%)
AAA 568..701 CDD:278434 38/138 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.