DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Pex6

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_663463.1 Gene:Pex6 / 224824 MGIID:2385054 Length:981 Species:Mus musculus


Alignment Length:312 Identity:99/312 - (31%)
Similarity:161/312 - (51%) Gaps:29/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAEQE-------GFKLRGQEFSDY--ELMIASHLVV--PADITVSWADIAGLDSVIQELRESVVL 115
            |:|::       ||.|..::|...  :|..|....|  |...:|||.|:.||..|.:|:.|::.|
Mouse   660 LSEEDEGDLCVAGFPLLAEDFGQALDQLQTAHSQAVGAPRIPSVSWHDVGGLQDVKKEILETIQL 724

  Fly   116 PIQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLT 180
            |::|.:|.   .|.....|:|||||||.||||:|||.|.|..:.|:::....|.:.:.|:|::..
Mouse   725 PLEHPELL---SLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENV 786

  Fly   181 SAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAM--MKTQFMMLWDGLSTNANSTVIVMGAT 243
            ..||:.|....|||||.||:||...||..:......|  :.:|.:...|||  ::...|.|:|||
Mouse   787 REVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGL--HSTQDVFVIGAT 849

  Fly   244 NRPQDLDKAIVRRMPAQF----HIGLPSE-TQRKDILKLILQSEEVSQDVDL-NRLSKLTNGFSG 302
            |||..||.|::|  |.:|    .:|...: ..:..:|..|.:..::...|.| |.|.......:|
Mouse   850 NRPDLLDPALLR--PGRFDKLVFVGASEDRASQLRVLSAITRKFKLEASVSLANVLDCCPPQLTG 912

  Fly   303 SDLREMCRNASVYRMRQLITSRD-PSATALDRNNVRITMDDLLGSHLKIKES 353
            :||..:|.:|.:..:::.:  || .....|..:.:.:||:|||.:..:::.|
Mouse   913 ADLYSLCSDAMMTALKRRV--RDLEEGLELRSSALLLTMEDLLQAAARLQPS 962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 55/139 (40%)
AAA 135..265 CDD:278434 53/135 (39%)
Pex6NP_663463.1 SpoVK 464..968 CDD:223540 99/312 (32%)
AAA 467..596 CDD:278434
AAA 744..872 CDD:278434 51/131 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.